PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011390t1
Common NameTCM_011390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 198aa    MW: 22605.6 Da    PI: 6.5108
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011390t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-1482131554
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                       +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++ ++
  Thecc1EG011390t1  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVIRLRNENHSLMDKLNHVSE 131
                       79******************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-1678142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.79580131IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-1382155No hitNo description
PfamPF001702.5E-1282131IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.88E-1382131No hitNo description
CDDcd147022.58E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MIPGELTGLR YLAPENPILI PANLGMMQNT IPDFNFNRFL SNLPISHIPL PAHEFTAQSS  60
SISNHSTSDE AEEHQLSIID ERKQRRMISN RESARRSRMR KQKHLDELWS QVIRLRNENH  120
SLMDKLNHVS ECHDLVLQEN ARLKEEASDL RQMLTDLKIG SPYSLALREL EDIPCNTAHL  180
RAESTNQSIA NSVDLLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045693.11e-143Basic leucine-zipper 42
SwissprotQ9FMC21e-38BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A061E9471e-143A0A061E947_THECC; Basic leucine-zipper 42
STRINGVIT_01s0010g00930.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-48basic leucine-zipper 42
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]